| Desktop | 76/100 | ❗ |
| Mobile | 73/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 17 KB | ✔ |
| Compression | 5 KB (-67.2%) | ✔ |
| Text/Html Ratio | 3046 / 16949 (bytes) = 17.97% | ✔ |
| Load Time | 1.63 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 30 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-GB | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | No | ✘ |
| Url Rewrite | No | ✔ |
| Underscores in url | Yes | ✘ | Images Without ALT | 0 / 16 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| wash | 24 | ✔ | ✔ | ✔ |
| happy | 7 | ✔ | ✔ | ✔ |
| automatic | 4 | ✘ | ✔ | ✘ |
| open | 4 | ✘ | ✘ | ✔ |
| self-serve | 3 | ✘ | ✔ | ✘ |
| credit | 3 | ✘ | ✘ | ✘ |
| great | 2 | ✘ | ✘ | ✘ |
| offer | 2 | ✘ | ✔ | ✘ |
| turbo | 2 | ✘ | ✘ | ✘ |
| products | 2 | ✘ | ✔ | ✘ |
| bays | 2 | ✘ | ✔ | ✘ |
| following | 2 | ✘ | ✘ | ✘ |
| cuyamaca | 2 | ✘ | ✘ | ✘ |
| it's | 2 | ✘ | ✘ | ✘ |
| best | 2 | ✘ | ✘ | ✘ |
|
With 1.63 seconds in page load, 17 KB of page size and all other reports below, the paradisehillsselfservecarwash.com has a SEO score of 54 out of 100 |
| Title | Happy Cow Car Wash - Home |
| Description | Happy Cow Car Wash has 4 locations in San Diego: El Cajon, Rancho San Diego, Mission Gorge and Paradise Hills. We offer self-serve car wash bays, automatic car wash bays, vacuums, vending machines for products and an ATM. We also have a World Famous Laser Show Car Wash at our El Cajon location! |
| Keyword | happy cow car wash, happycowcarwash.com, happy cow, car wash, carwash, El Cajon, Rancho San Diego, Paradise Hills, Mission Gorge, locations, Fletcher Parkway, Santee, Hand Wash, Super Vacuums, High Pressure, Soap, Brushes, Rainbow Wax, Tri Foam Wax, Clear Coat, Bright Lights, Open 24 hours, Shade, Canopies, Self Serve, Automatics, Touchless, Friction wash, Roll over wash, Detail Shop, Window tint, Armor all, armorall, Air fresheners, Towels, Soda, Water sold, Vending machine, Spot free rinse, Tire cleaner, Pre soap, Debug, Mat holders, Truck wash, Stairs railing, Brush Wash, san diego county, Automatic Brush Wash, Automatic Touchless Wash, mission gorge, mission valley, designed by josh gilson, joshgilson.com |
| Age | 11 Years, 103 Days |
| Created | 21st-Jul-2009 |
| Updated | 12th-Jul-2017 |
| Expiry | 21st-Jul-2022 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| paradisehillsselfservecarwash.com | A | 14385 | ip:65.99.240.138 |
| paradisehillsselfservecarwash.com | NS | 86400 | target:ns2.joshgilson.com |
| paradisehillsselfservecarwash.com | NS | 86400 | target:ns1.joshgilson.com |
| paradisehillsselfservecarwash.com | SOA | 86400 | mname:ns1.joshgilson.comrname:dnsadmin.joshgilson1.directrouter.comserial:2018051200refresh:86400retry:7200expire:3600000minimum-ttl:86400 |
| paradisehillsselfservecarwash.com | MX | 14400 | pri:0target:paradisehillsselfservecarwash.com |
|
IP Address: 172.105.38.181 Maximum Daily connection limit reached. Lookup refused. |
| Server IP | 65.99.240.138 |
| Server Location | United States |
| Service Provider | TierPoint, LLC |
| Domains (TLD) | Status |
|---|---|
| paradisehillsselfservecarwash.net | Available |
| paradisehillsselfservecarwash.org | Already Registered |
| paradisehillsselfservecarwash.biz | Already Registered |
| paradisehillsselfservecarwash.io | Already Registered |
| paradisehillsselfservecarwash.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| paradisehilselfservecarwash.com | Available |
| oaradisehillsselfservecarwash.com | Available |
| laradisehillsselfservecarwash.com | Available |
| pqradisehillsselfservecarwash.com | Available |
| pwradisehillsselfservecarwash.com | Available |